PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10036453
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 303aa    MW: 33498.8 Da    PI: 6.109
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10036453genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.42.2e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rgrW +eEd++l  +++++G g W++ ++  g+ R++k+c++rw +yl
      Lus10036453 14 RGRWAAEEDQILTAYIRLHGEGKWRSLPKDAGLLRCGKSCRLRWINYL 61
                     89******************************99************97 PP

2Myb_DNA-binding46.49.4e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ T++E+e +v+++  lG++ W++Ia+ +  gRt++++ ++w+++l
      Lus10036453  67 RGNITKDEEEAIVKLHSSLGNR-WSLIAAQLS-GRTDNEIMNYWNSHL 112
                      7999******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-21564IPR009057Homeodomain-like
PROSITE profilePS5129415.897961IPR017930Myb domain
SuperFamilySSF466891.17E-2511108IPR009057Homeodomain-like
SMARTSM007179.9E-111363IPR001005SANT/Myb domain
PfamPF002498.4E-131461IPR001005SANT/Myb domain
CDDcd001675.38E-81661No hitNo description
PROSITE profilePS5129424.01962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.9E-2365116IPR009057Homeodomain-like
SMARTSM007172.0E-1466114IPR001005SANT/Myb domain
PfamPF002491.3E-1267112IPR001005SANT/Myb domain
CDDcd001675.24E-971112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051555Biological Processflavonol biosynthetic process
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MGRAPCCEKV GLKRGRWAAE EDQILTAYIR LHGEGKWRSL PKDAGLLRCG KSCRLRWINY  60
LRDDLKRGNI TKDEEEAIVK LHSSLGNRWS LIAAQLSGRT DNEIMNYWNS HLRRKIYTFH  120
TVGQPHSPCL ESSSSASSSS TSPSSTRSRN SKRPPSLVTA GGGSKEDHGE IAACGDQLQE  180
LRMDEEKVAE DHAAGPYEWL DSEMNRLIKS RVVLHEDSPS GEMKDADDHG GGGGGGSSCN  240
SNSSDNQRSS SVSQQWLDWE QITGGGEINY SSNHHHHHHN DVVWDEGEDD VLLSWLLDGV  300
DP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-211211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00598PBMTransfer from AT5G49330Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006419436.12e-75hypothetical protein CICLE_v10005376mg
RefseqXP_006488874.12e-75PREDICTED: myb-related protein Myb4
RefseqXP_006488875.12e-75PREDICTED: myb-related protein Myb4
TrEMBLA0A067G0C92e-75A0A067G0C9_CITSI; Uncharacterized protein
TrEMBLV4S7212e-75V4S721_9R
STRINGAT5G49330.14e-74(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49330.13e-74myb domain protein 111